PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02041g05003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 271aa    MW: 30347.9 Da    PI: 5.6102
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02041g05003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.6e-2191151257
                               T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                               r+R+t+t+ ql++Le+ F + n +ps+++++e+++ l    +++e++V++WFqNrRa+ k+
  Niben101Scf02041g05003.1  91 RQRWTPTPMQLQILERIFDQgNGTPSKQKIKEITSDLsqhgQISETNVYNWFQNRRARSKR 151
                               89*****************99**************************************97 PP

2Wus_type_Homeobox101.65.6e-3391153365
         Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                               r+RWtPtp Q++iLe+++++G  tP+k++i++it+ L+++G+i+++NV++WFQNr+aR+++kq
  Niben101Scf02041g05003.1  91 RQRWTPTPMQLQILERIFDQGNGTPSKQKIKEITSDLSQHGQISETNVYNWFQNRRARSKRKQ 153
                               89***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.99787152IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.1E-1887157IPR009057Homeodomain-like
SMARTSM003891.1E-1489156IPR001356Homeobox domain
SuperFamilySSF466898.98E-1989156IPR009057Homeodomain-like
PfamPF000462.4E-1991151IPR001356Homeobox domain
CDDcd000862.01E-1491153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEWDMQQPPQ QPPQTAEELG GGGGGGMFVK VMTDEQMEVL RKQIAVYATI CEQLVDLHKS  60
MASQHDLAGV RLGNLYCDPL VTSAGHKITG RQRWTPTPMQ LQILERIFDQ GNGTPSKQKI  120
KEITSDLSQH GQISETNVYN WFQNRRARSK RKQQVATTNN TESEVETEVE SPNEKKTRPE  180
DLQSPHMPTS RAEDVGYQNP DVSSGMHSLD PRTSKPEPVF PSEGTSKPAG SYGEMSFYGM  240
SNPRMDQIMG KMEVPGSYHP YLHAEDYNMT G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777417.10.0PREDICTED: WUSCHEL-related homeobox 8-like
RefseqXP_016442227.10.0PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM31e-87WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLK4BAD71e-175K4BAD7_SOLLC; Uncharacterized protein
STRINGSolyc02g082670.2.11e-174(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56752437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.14e-81WUSCHEL related homeobox 13